PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID C.cajan_35228
Common NameKK1_032238
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Cajanus
Family MYB
Protein Properties Length: 338aa    MW: 37315.7 Da    PI: 7.0777
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
C.cajan_35228genomeIIPGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding57.72.7e-181461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg WT+eEd +++ +v  +G+g+W++++++ g++R++k+c++rw +yl
    C.cajan_35228 14 RGLWTPEEDAKILAYVSNHGTGNWTLVPKKAGLNRCGKSCRLRWTNYL 61
                     788*******************************************97 PP

2Myb_DNA-binding46.68e-1569110346
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      ++T++E+el+++++   G++ W++Ia++++ gRt++++k++w++
    C.cajan_35228  69 SFTAQEEELIINLHGAIGSR-WSLIAKRLP-GRTDNDVKNYWNT 110
                      79******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.3E-25564IPR009057Homeodomain-like
PROSITE profilePS5129427.197965IPR017930Myb domain
SuperFamilySSF466892.34E-3011108IPR009057Homeodomain-like
SMARTSM007179.1E-151363IPR001005SANT/Myb domain
PfamPF002494.8E-171461IPR001005SANT/Myb domain
CDDcd001671.18E-111761No hitNo description
Gene3DG3DSA:1.10.10.609.1E-2465116IPR009057Homeodomain-like
SMARTSM007176.7E-1466114IPR001005SANT/Myb domain
PROSITE profilePS5129418.11466116IPR017930Myb domain
PfamPF002492.6E-1369110IPR001005SANT/Myb domain
CDDcd001677.17E-1169112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0048658Biological Processanther wall tapetum development
GO:0052545Biological Processcallose localization
GO:0055046Biological Processmicrogametogenesis
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 338 aa     Download sequence    Send to blast
MGRPPCCDKS NVKRGLWTPE EDAKILAYVS NHGTGNWTLV PKKAGLNRCG KSCRLRWTNY  60
LRPDLKHDSF TAQEEELIIN LHGAIGSRWS LIAKRLPGRT DNDVKNYWNT KLRKKLMKMG  120
IDPVTHKPVS QVLSDLGSIS GLPNTSNQMA FVNKDLMSNM LPTKTEPSGS NKSMLEHTQE  180
DQVPSWGEHQ VPYQIINSEN VLSEVASSTS SSSSSNLTHL GSPKSYSCQT TQAHVAPLNC  240
SSFDWSEFLQ SDSFVWSLNP SGLILQSEAE LSNNTKSNNG HDKQGTSNQG SGVVACGTSM  300
QHQINKQCEG HSFVDGILDR DSEIRAAFPE LLDASFDY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-28141167108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150441e-162AP015044.1 Vigna angularis var. angularis DNA, chromosome 11, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014627228.10.0PREDICTED: transcription factor MYB35-like
SwissprotQ9LSI72e-86MYB35_ARATH; Transcription factor MYB35
TrEMBLA0A151RUI00.0A0A151RUI0_CAJCA; Myb-related protein Zm38
STRINGGLYMA19G02090.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF29423474
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G28470.15e-87MYB family protein